HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS		QUICK SEARCH:   [advanced] Author: Keyword(s): Year:  Vol:  Page:

This Article Full Text (PDF) Alert me when this article is cited Alert me if a correction is posted Citation Map Services Email this article to a friend Similar articles in this journal Similar articles in PubMed Alert me to new issues of the journal Download to citation manager Request Permissions Citing Articles Citing Articles via HighWire Citing Articles via Google Scholar Google Scholar Articles by Aketagawa, J. Articles by Shimonishi, Y. Search for Related Content PubMed PubMed Citation Articles by Aketagawa, J. Articles by Shimonishi, Y. Social Bookmarking                      What's this?

J. Biol. Chem., Vol. 261, Issue 16, 7357-7365, 06, 1986

Primary structure of limulus anticoagulant anti-lipopolysaccharide factor

J Aketagawa, T Miyata, S Ohtsubo, T Nakamura, T Morita, H Hayashida, T Miyata, S Iwanaga, T Takao and Y Shimonishi

A potent anticoagulant, anti-lipopolysaccharide (LPS) factor, found in limulus hemocytes inhibits the LPS-mediated activation of limulus coagulation cascade and shows an antibacterial action against R-types of Gram-negative bacteria (Morita, T., Ohtsubo, S., Nakamura, T., Tanaka, S., Iwanaga, S., Ohashi, K., and Niwa, M. (1985) J. Biochem. (Tokyo) 97, 1611-1620). The complete amino acid sequence of this substance was determined by sequencing the peptides obtained by selective proteolytic cleavage. The NH2-terminal end of anti-LPS factor was pyroglutamic acid. Anti-LPS factor had two variant residues at position 36 and the COOH-terminal end, respectively. The following sequence was assigned to anti-LPS factor, and it was also confirmed by fast atom bombardment mass spectrometry. less than EGGIWTQLALALVKNLATLWQSGDFQFLGHE (formula; see text) Limulus anti-LPS factor consisted of a single chain of 102 residues with 2 half-cystines in disulfide linkage. Its NH2-terminal region up to 20 residues was highly hydrophobic, and positively charged residues were clustered mainly within the disulfide loop. By searching the homologous sequence in known protein sequences with that of anti-LPS factor, we found a structural homology between anti-LPS factor and alpha- lactalbumin/lysozyme family.
CiteULike    Complore    Connotea    Del.icio.us    Digg    Reddit    Technorati    What's this?

This article has been cited by other articles:

				T. Koshiba, T. Hashii, and S.-i. Kawabata A Structural Perspective on the Interaction between Lipopolysaccharide and Factor C, a Receptor Involved in Recognition of Gram-negative Bacteria J. Biol. Chem., February 9, 2007; 282(6): 3962 - 3967. [Abstract] [Full Text] [PDF]

				M. T. Armstrong, S. M. Theg, N. Braun, N. Wainwright, R. L. Pardy, and P. B. Armstrong Histochemical evidence for lipid A (endotoxin) in eukaryote chloroplasts FASEB J, October 1, 2006; 20(12): 2145 - 2146. [Abstract] [Full Text] [PDF]

				J. A. Tincu and S. W. Taylor Antimicrobial Peptides from Marine Invertebrates Antimicrob. Agents Chemother., October 1, 2004; 48(10): 3645 - 3654. [Full Text] [PDF]

				P. B. Armstrong, M. T. Armstrong, R. L. Pardy, A. Child, and N. Wainwright Immunohistochemical Demonstration of a Lipopolysaccharide in the Cell Wall of a Eukaryote, the Green Alga, Chlorella Biol. Bull., October 1, 2002; 203(2): 203 - 204. [Full Text] [PDF]

				S. Dankesreiter, A. Hoess, J. Schneider-Mergener, H. Wagner, and T. Miethke Synthetic Endotoxin-Binding Peptides Block Endotoxin- Triggered TNF-{alpha} Production by Macrophages In Vitro and In Vivo and Prevent Endotoxin-Mediated Toxic Shock J. Immunol., May 1, 2000; 164(9): 4804 - 4811. [Abstract] [Full Text] [PDF]

				R. J. Ridge, E. J. Paus, T. J. Novitsky, and P. A. Ketchum Reversible binding of heparin to the loop peptide of endotoxin neutralizing protein Innate Immunity, February 1, 2000; 6(1): 17 - 23. [Abstract] [PDF]

				S. Azumi and K.-i. Tanamoto Anti-endotoxin properties of a cinnamon bark-derived compound and its effect on the endotoxin shock model Innate Immunity, June 1, 1999; 5(3): 109 - 117. [Abstract] [PDF]

				A.W.M. Pui, B. Ho, and J.L. Ding Yeast recombinant Factor C from horseshoe crab binds endotoxin and causes bacteriostasis Innate Immunity, December 1, 1997; 4(6): 391 - 400. [Abstract] [PDF]

				C. Ried, C. Wahl, T. Miethke, G. Wellnhofer, C. Landgraf, J. Schneider-Mergener, and A. Hoess High Affinity Endotoxin-binding and Neutralizing Peptides Based on the Crystal Structure of Recombinant Limulus Anti-lipopolysaccharide Factor J. Biol. Chem., November 8, 1996; 271(45): 28120 - 28127. [Abstract] [Full Text] [PDF]

				K. L. Agarwala, S.-i. Kawabata, Y. Miura, Y. Kuroki, and S. Iwanaga Limulus Intracellular Coagulation Inhibitor Type 3. PURIFICATION, CHARACTERIZATION, cDNA CLONING, AND TISSUE LOCALIZATION J. Biol. Chem., September 27, 1996; 271(39): 23768 - 23774. [Abstract] [Full Text] [PDF]

				M. A. Fletcher, M. Kloczewiak, P. M. Loiselle, S. F. Amato, K. M. Black, and H. S. Warren TALF peptide-immunoglobulin G conjugates that bind lipopolysaccharide Innate Immunity, February 1, 1996; 3(1): 49 - 55. [Abstract] [PDF]

				T. Saito, S.-i. Kawabata, M. Hirata, and S. Iwanaga A Novel Type of limulus Lectin-L6 J. Biol. Chem., June 16, 1995; 270(24): 14493 - 14499. [Abstract] [Full Text] [PDF]

				Y. Miura, S.-i. Kawabata, Y. Wakamiya, T. Nakamura, and S. Iwanaga A Limulus Intracellular Coagulation Inhibitor Type 2 J. Biol. Chem., January 13, 1995; 270(2): 558 - 565. [Abstract] [Full Text] [PDF]

				T. Muta, N. Seki, Y. Takaki, R. Hashimoto, T. Oda, A. Iwanaga, F. Tokunaga, and S. Iwanaga Purified Horseshoe Crab Factor G J. Biol. Chem., January 13, 1995; 270(2): 892 - 897. [Abstract] [Full Text] [PDF]