J. Biol. Chem., Vol. 261, Issue 19, 8674-8677, Jul, 1986
Isolation and structure of the second of two major peptide products from the precursor to an anglerfish peptide homologous to neuropeptide Y
PC Andrews and JE Dixon
The peptide hormone recently isolated from anglerfish endocrine pancreas
(aPY) (Andrews, P. C., Hawke, D., Shively, J.E., and Dixon, J.E. (1985)
Endocrinology 116, 2677-2681), is a member of a family of peptide hormones
which includes pancreatic polypeptide, neuropeptide Y, and the gut peptide
YY. A 30-residue carboxyl-terminal fragment of the precursor to aPY has
been purified from anglerfish endocrine pancreas in two steps using both
classical chromatographic methods and reversed- phase high pressure liquid
chromatography. It was identified by sequence homology with the analogous
peptide from human preproneuropeptide Y. The sequence was found by Edman
degradation and fast atom bombardment mass spectrometry to be
SSPEEAVAWLLFKADPSQDIEPRLDDDNAW. The high yield of this fragment (6.5 nmol .
g-1) is similar to that previously reported for aPY (7.9 nmol . g-1) and
suggests that it is a major product of pro-aPY processing. The data
indicate that pro-aPY is proteolytically processed into two major products:
the 37-residue aPY and the 30-residue carboxyl-terminal fragment.