JBC PeproTech; Our Business is Cytokines!

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Alessi, D. R.
Right arrow Articles by Saltiel, A. R.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Alessi, D. R.
Right arrow Articles by Saltiel, A. R.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Volume 270, Number 46, Issue of November 17, 1995 pp. 27489-27494
©1995 by The American Society for Biochemistry and Molecular Biology, Inc.
PD 098059 Is a Specific Inhibitor of the Activation of Mitogen-activated Protein Kinase Kinase in Vitro and in Vivo(*)

(Received for publication, May 9, 1995; and in revised form, August 8, 1995)

Dario R. Alessi (1)(§) Ana Cuenda (1)(¶) Philip Cohen (1) David T. Dudley (2) Alan R. Saltiel (2)

From the  (1)MRC Protein Phosphorylation Unit, Department of Biochemistry, Medical Sciences Institute, The University, Dundee DD14HN and the (2)Department of Signal Transduction, Parke Davis Research Division, Warner Lambert Company, Ann Arbor, Michigan 48105

ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
FOOTNOTES
REFERENCES

ABSTRACT

PD 098059 has been shown previously to inhibit the dephosphorylated form of mitogen-activated protein kinase kinase-1 (MAPKK1) and a mutant MAPKK1(S217E,S221E), which has low levels of constitutive activity (Dudley, D. T., Pang, L., Decker, S. J., Bridges, A. J., and Saltiel, A. R.(1995) Proc. Natl. Acad. Sci. U. S. A. 92, 7686-7689). Here we report that PD 098059 does not inhibit Raf-activated MAPKK1 but that it prevents the activation of MAPKK1 by Raf or MEK kinase in vitro at concentrations (IC = 2-7 µM) similar to those concentrations that inhibit dephosphorylated MAPKK1 or MAPKK1(S217E,S221E). PD 098059 inhibited the activation of MAPKK2 by Raf with a much higher IC value (50 µM) and did not inhibit the phosphorylation of other Raf or MEK kinase substrates, indicating that it exerts its effect by binding to the inactive form of MAPKK1. PD 098059 also acts as a specific inhibitor of the activation of MAPKK in Swiss 3T3 cells, suppressing by 80-90% its activation by a variety of agonists. The high degree of specificity of PD 098059 in vitro and in vivo is indicated by its failure to inhibit 18 protein Ser/Thr kinases (including two other MAPKK homologues) in vitro by its failure to inhibit the in vivo activation of MAPKK and MAP kinase homologues that participate in stress and interleukin-1-stimulated kinase cascades in KB and PC12 cells, and by lack of inhibition of the activation of p70 S6 kinase by insulin or epidermal growth factor in Swiss 3T3 cells. PD 098059 (50 µM) inhibited the activation of p42 and isoforms of MAP kinase-activated protein kinase-1 in Swiss 3T3 cells, but the extent of inhibition depended on how potently c-Raf and MAPKK were activated by any particular agonist and demonstrated the enormous amplification potential of this kinase cascade. PD 098059 not only failed to inhibit the activation of Raf by platelet-derived growth factor, serum, insulin, and phorbol esters in Swiss 3T3 cells but actually enhanced Raf activity. The rate of activation of Raf by platelet-derived growth factor was increased 3-fold, and the subsequent inactivation that occurred after 10 min was prevented. These results indicate that the activation of Raf is suppressed and that its inactivation is accelerated by a downstream component(s) of the MAP kinase pathway.


INTRODUCTION

Stimulation of cells with growth factors and cytokines, or exposure to cellular stresses, activates several signal transduction pathways that have specific physiological roles. These include at least three in which a mitogen-activated protein kinase (MAPK) (^1)homologue is involved. In one pathway, cell stimulation leads to the sequential activation of p21 and the protein kinases c-Raf, MAP kinase kinase-1 and -2 (MAPKK1, MAPKK2), and p42 and p44 MAP kinases (p42, p44). These MAPKs phosphorylate a variety of proteins in vivo including MAP kinase-activated protein (MAPKAP) kinases 1alpha and 1beta (also known as Rsk-1 and Rsk-2(1) ). The sustained activation of p42/p44 is not only required, but it is sufficient to induce the proliferation or differentiation of several cells(2) .

In order to dissect MAPK pathways and to elucidate their physiological roles, one approach has been to generate dominant negative mutants and overexpress them in cells. For example, dominant negative forms of p21, c-Raf, and MAPKK1 all inhibit the activation of p42/p44 and the growth factor-induced proliferation or differentiation of several cells(3) . However, although dominant-negative mutants are useful, the generation of cell lines that stably express them is time consuming, and their expression may lead to erroneous conclusions. For example, overexpression of an inactive form of MAPKK1 that can be phosphorylated by Raf may not only prevent the activation of endogenous wild-type MAPKK1, but also the activation of other cellular substrates of Raf that might lie in distinct signaling pathways. The need to express a dominant negative mutant for many hours may also result in unwanted secondary effects. Similarly, the use of dominant negative mutants of Raf may affect Ras-dependent processes that are independent of Raf.

An alternative strategy is to identify small cell-permeant molecules that are specific inhibitors of particular protein kinases. An advantage of this approach is that the effects of these inhibitors can be investigated in any cell in vivo. Moreover, these inhibitors may have therapeutic potential as anti-cancer, or anti-inflammatory agents, or as immunosuppressants. Several such inhibitors have recently been described, including an inhibitor of the epidermal growth factor (EGF) receptor tyrosine kinase(4) , which may be useful for treating human tumors that overexpress this receptor, and a specific inhibitor of the MAP kinase homologue termed reactivating kinase (RK) or p38(5) . The latter inhibitor prevents the synthesis of interleukin-1 (IL-1) and tumor necrosis factor in monocytes induced by bacterial endotoxins and also blocks several actions of these cytokines on other cells(6) . For these reasons, it may be efficaceous in the treatment of inflammatory diseases, such as rheumatoid arthritis. Another compound, rapamycin, prevents the IL-2-induced activation of p70 S6 kinase and the proliferation of T-cells (7, 8) and may therefore be useful as an immunosuppressant.

One of our laboratories recently described the first synthetic inhibitor of the MAP kinase pathway. This substance, PD 098059 (Fig. 1) was identified as a noncompetitive inhibitor of MAP kinase kinase (MAPKK) by screening a compound library using a MAP kinase cascade assay comprising unphosphorylated MAPKK1 (which possesses low basal activity) and unphosphorylated MAP kinase and monitoring phosphorylation of myelin basic protein. PD 098059 was subsequently demonstrated to inhibit the constitutively active mutant (MAPKK1(S217E,S221E)) in which the serine residues phosphorylated by c-Raf had been mutated to glutamic acid(9) . PD 098059 inhibited the activation of MAP kinase by growth factors in vivo and, consistent with a key role for this pathway in the proliferation of some cells and the differentiation of others, it reversed the transformed phenotype induced by Ras overexpression in KRNK and K-balb cells (9) or the nerve growth factor (NGF)-induced differentiation of PC12 cells(10) . We now report that although PD 098059 inhibits MAPKK1(S217E, S221E), it surprisingly has no effect on MAPKK1 or MAPKK2 that have been activated by Raf. This remarkable finding has led us to demonstrate that PD 098059 blocks the activation of MAPKK1 by Raf or MEK kinase in vitro and that it acts in vivo as a highly specific inhibitor of the activation of MAPKK.


Figure 1: Structure of PD 098059.




EXPERIMENTAL PROCEDURES

Materials

Tissue culture reagents, EGF, and platelet-derived growth factor-BB (PDGF), rapamycin, and myelin basic protein were obtained from Life Technologies, Inc.; insulin was from Novo-Nordisk (Bagsvaerd, Denmark); 12-O-tetradecanoylphorbol 13-acetate (TPA) and human IL-1alpha were from Boehringer Mannheim; sodium arsenite and partially hydrolyzed and dephosphorylated casein were from Sigma; Protein G-Sepharose was from Pharmacia Biotech Inc. Polyclonal c-Raf antibody was raised in sheep against the C-terminal peptide CTLTTSPRLPVF and affinity-purified on peptide-AffiGel 15. p42 antiserum (number 122) raised in rabbits against the C-terminal peptide EETARFQPGYRS was provided by Dr C. J. Marshall (Institute for Cancer Research, London). Affinity-purified polyclonal MAPKAP kinase-1alpha antibody raised in rabbits against the peptide QLVKGAMMATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL was purchased from UBI (Lake Placid, NY), and affinity-purified polyclonal MAPKAP kinase-1beta and p70 S6 kinase antibodies were raised in sheep against the peptides RNQSPVLEPVGRSTLAQRRGIKK and AGVFDILDQPEDAGSEDEL, respectively. c-Raf was coexpressed in Sf9 cells with oncogenic ras and the protein tyrosine kinase lck(11) and immunoprecipitated from the lysates as described (12) except that Protein A-Sepharose was replaced by Protein G-Sepharose. p42(13) , MAPKK1(11) , and the catalytic domain of MEK kinase corresponding to residues 366-675 (14) were expressed in Escherichia coli as glutathione S-transferase fusion proteins and purified by affinity chromatography on glutathione-Sepharose(11) . The MEK kinase construct was provided by Dr A. Ashworth (Institute for Cancer Research, London). MAPKK2 expressed in insect cells and partially purified was a gift from Drs K. Zeller and T. Sturgill (University of Virginia). The inactive and active forms of the MAPKK homologue, termed MKK4(15) , were partially purified by Mono S chromatography of extracts from unstimulated or osmotically shocked PC12 cells, respectively. The active form of RK kinase, the major MAPKK homologue that activates RK in KB cells and might be similar to MKK3(15) , was partially purified by Mono S chromatography of extracts from IL-1-stimulated KB cells. The catalytic subunit of protein phosphatase 2A (PP2A) from bovine heart was provided by Dr. R. MacKintosh (University of Dundee).

Protein Kinase Assays

c-Raf and MEK kinase were measured by their ability to activate MAPKK1 (or MAPKK2) in a 30-min coupled assay containing MAPKK1 (or MAPKK2) and its substrate p42 MAP kinase. One unit of c-Raf or MEK kinase activity was that amount which increased the activity of p42 by 1 unit/min. MAPKK was assayed directly in the cell lysate by the activation of bacterially expressed p42 (16). One unit of MAPKK was that amount which increased the activity of p42 by 1 unit/min. The assays of c-Raf and MAPKK are quantitative and extremely sensitive and are detailed elsewhere(16) .

p42 was assayed by its ability to phosphorylate myelin basic protein (16) and MAPKAP kinase 1 alpha/beta by the phosphorylation of a peptide related to the C terminus of ribosomal protein S6 [Gly-245,Gly-246]S6-(218-249)(1, 17) . One unit of p42 or MAPKAP kinase-1alpha/beta was that amount which catalyzed the phosphorylation of 1 nmol of substrate peptide in 1 min. Protein kinase activities in immunoprecipitates were measured by adding the other assay components to the tubes containing the immunoprecipitated enzyme.

RK kinase from KB cells and MKK4 from PC12 cells were assayed by the activation of RK(18) . RK itself(18) , MAPKAP kinase-2(18) , p70 S6 kinase(19) , protein kinase A(20) , protein kinase Calpha(21) , 5`-AMP-activated protein kinase(22) , cyclin A cyclin-dependent protein kinase-2(23) , phosphorylase kinase(24) , glycogen synthase kinase-3 alpha/beta(17) , and myosin light chain kinase (25) were assayed as described previously. c-Jun kinase (JNK) from IL-1-stimulated KB cells was assayed using a GST-c-Jun-(1-191) fusion protein(26) , a gift from Dr. R. Treisman (Imperial Cancer Research Fund, London).

Assay of c-Raf and MEK Kinase by the Phosphorylation of MAPKK and Other Proteins

c-Raf was assayed by the activation of MAPKK (16) except for the following modifications. The reaction (20 µl) contained. Buffer B (1.0 ml of 50 mM Tris/HCl, pH 7.5, 0.1 mM EGTA, 0.03% (w/v) Brij 35, 0.1% (v/v) 2-mercaptoethanol). MAPKK (1.4 µg), c-Raf immunoprecipitate (0.75 units of activity coupled to 5 µl of packed Protein G-Sepharose) or MEK kinase (0.75 units), 10 mM magnesium acetate, 0.1 mM [-P]ATP (1 cpm/fmol). The assays were initiated with MgATP after incubating the other components for 5 min at 30 °C. After 30 min, the samples were denatured in SDS and electrophoresed on a 10% polyacrylamide gel, and the radioactivity in each band was quantitated using a PhosphorImager. The phosphorylation of myelin basic protein (0.2 mg/ml) and casein (0.5 mg/ml) was carried out in an identical manner, except that the concentration of c-Raf was increased 100-fold.

Cell Culture and Stimulation

Mouse Swiss 3T3 fibroblasts (27) , human KB fibroblasts(5) , and PC12 cells (18) were cultured to confluence. After stimulation with growth factors, IL-1, or arsenite for the times indicated, each 10-cm dish of cells was lysed in 0.4 ml of ice-cold Buffer A (20 mM Tris acetate, pH 7.5, 0.1% (by mass) Triton X-100, 1 mM EDTA, 1 mM EGTA, 50 mM sodium fluoride, 10 mM sodium beta-glycerophosphate, 5 mM sodium pyrophosphate, 1 mM sodium orthovanadate, 0.1% (by volume) 2-mercaptoethanol, 0.1 mM phenylmethylsulfonyl fluoride, 1 mM benzamidine, 5 µg/ml leupeptin, 10 µg/ml aprotinin), and the lysates were frozen immediately in liquid nitrogen and stored at -80 °C until use. Protein concentrations were determined by the Bradford method(28) .

Use of PD 098059

PD 098059 was dissolved in dimethyl sulfoxide (Me(2)SO) to give a concentration of 50 mM, stored in aliquots at -80 °C, and diluted in aqueous buffers to <100 µM immediately prior to use. For studies in vitro, PD 098059 or the equivalent amount of Me(2)SO carried over with the drug was incubated with protein kinases for 10 min before initiating the assays with MgATP. For studies in vivo, PD 098059 was added to the culture medium to give a final concentration of 50 µM, and 90 min later the cells were stimulated with growth factors (although similar results were obtained if the preincubation was only 30 min or as long as 16 h). Control incubations contained Me(2)SO instead of PD 098059. The maximum concentration of Me(2)SO in any experiment was 0.1% (v/v), which did not affect the activity or activation of any protein kinase examined.

Immunoprecipitation of Protein Kinases

Cell lysates were thawed and centrifuged for 2 min at 14,000 times g, and the supernatants were incubated for 90 min at 4 °C on a shaking platform with 5 µl of protein G-Sepharose conjugated to the appropriate antibody. The suspensions were centrifuged for 1 min at 14,000 times g, the supernatant was discarded, and the immunoprecipitates were washed twice with 1.0 ml of Buffer A containing 0.5 M NaCl and twice with Buffer B prior to assay.

c-Raf

Swiss 3T3 lysate (40-400 µg of protein) was immunoprecipitated using 1 µg of c-Raf antibody.

p42

Swiss 3T3 lysates (10 µg of protein) were immunoprecipitated using 1 µl of p42 antiserum.

MAPKAP Kinase-1 alpha and beta

The MAPKAP kinase-1alpha antibody does not immunoprecipitate MAPKAP kinase-1beta, but the MAPKAP kinase-1beta antibody immunoprecipitates both MAPKAP kinase-1beta and MAPKAP kinase-1alpha. In order to assay each isoform of MAPKAP kinase-1, Swiss 3T3 cell lysate (20 µg of protein) was incubated for 90 min at 4 °C on a shaking platform with 5 µl of Protein G-Sepharose conjugated to 1 µg of MAPKAP-kinase 1alpha antibody. The suspension was centrifuged for 1 min at 14,000 times g, and the supernatant was added to 5 µl of Protein G-Sepharose conjugated to 2 µg of MAPKAP kinase-1beta antibody. Under these conditions >90% of the MAPKAP kinase-1alpha and MAPKAP kinase-1beta was immunoprecipitated sequentially from the lysates.

p70

This enzyme was immunoprecipitated from Swiss 3T3 lysates (60 µg of protein) using 2.5 µg of p70 antibody.


RESULTS

Effect of PD 098059 on the Activity and Activation of MAP Kinase Kinase in Vitro

The dephosphorylated form of MAPKK1 has extremely low activity, which is increased 7000-fold after maximal phosphorylation with c-Raf. The activation of MAPKK1 results from the phosphorylation of Ser-217 and Ser-221, and mutating both residues to glutamate generates an enzyme (MAPKK(S217E,S221E)) that is 40-fold more active than dephosphorylated MAPKK but 180-fold less active than the phosphorylated enzyme(11) .

PD 098059 was identified during a screen to identify inhibitors of dephospho-MAPKK and was subsequently found to inhibit MAPKK(S217E,S221E). PD 098059 inhibited both of these enzymes with an IC of 2 µM. Inhibition was essentially complete at 50 µM ((9) ; see Fig. 2) and unaffected by prior incubation of bacterially expressed dephospho-MAPKK1 with PP2A under conditions that completely inactivated the phosphorylated form of MAPKK1 (data not shown). However, to our surprise, PD 098059 did not inhibit MAPKK1 that had been phosphorylated by c-Raf in vitro or MAPKK activity in cell lysates prepared from EGF-stimulated Swiss 3T3 cells (Fig. 2).


Figure 2: Effect of PD 098059 on the activity of different forms of MAPKK1. MAPKK activity was assayed after preincubation for 10 min with the indicated concentrations of PD 098059, and the results are presented relative to control incubations in which the inhibitor was omitted. The concentrations of MAPKK1 in the assays were as follows: dephospho-MAPKK1, 0.3 µM; MAPKK1(S217E,S217E), 10 nM; Raf-activated MAPKK1, 0.2 nM. Closed circles, MAPKK assayed in lysates from Swiss 3T3 cells stimulated for 2 min with EGF; open circles, MAPKK1 maximally phosphorylated at Ser-217 and Ser-221 by c-Raf; closed triangles, dephosphorylated MAPKK1; open triangles, MAPKK1(S217E,S221E). MAPKK1 maximally phosphorylated at Ser-217 and Ser-221 has a 7000-fold higher activity than the dephosphorylated enzyme and 180-fold higher activity than MAPKK1(S217E,S221E). Each MAPKK preparation was diluted to give similar MAPKK activity in the assay in the absence of PD 098059. Similar results were obtained in three experiments.



Since the phosphorylated form of MAPKK1 has a far higher activity than either MAPKK1(S217E,S221E) or dephospho-MAPKK1, these results suggested that PD 098059 might interact specifically with the inactive conformation of MAPKK and prompted us to investigate its effect on the activation of MAPKK1 in vitro. PD 098059 inhibited both the activation (Fig. 3A) and phosphorylation (Fig. 3B) of MAPKK1 in vitro by either c-Raf or MEK kinase with IC values of 4 ± 2 µM, similar to the IC for inhibition of dephospho-MAPKK1 or MAPKK1(S217E,S221E) (Fig. 2). Identical results were obtained using c-Raf expressed in insect Sf9 cells (Fig. 3) or immunoprecipitated from EGF-stimulated Swiss 3T3 cells (not shown). The activation of MAPKK2 by c-Raf was also inhibited by PD 098059 but over 10 times less potently (IC = 50 µM) than MAPKK1. Like Raf-activated MAPKK1, Raf-activated MAPKK2 was not inhibited by 50 µM PD 098059 (see Table 2).


Figure 3: Effect of PD 098059 on the activation and phosphorylation of MAPKK1 by c-Raf and MEK kinase in vitro. A, activation by c-Raf and MEK kinase. c-Raf and MEK kinase were diluted to achieve an equivalent reactivation of MAPKK1 in the absence of any inhibitor (100%). The MAPKK1 concentration in the assays was 0.3 µM. After a 10-min preincubation with the indicated concentration of PD 098059, c-Raf (open circles) and MEK kinase (closed circles) were assayed by the activation of MAPKK1. Similar results were obtained in three experiments. B, same as A, except that c-Raf or MEK kinase were assayed by the phosphorylation of MAPKK1 (see ``Experimental Procedures''). Similar results were obtained in two experiments.





In contrast to the inhibition of MAPKK1 phosphorylation by c-Raf and MEK kinase, PD 098059 did not inhibit the (weak) phosphorylation of myelin basic protein and casein (29) by c-Raf, the autophosphorylation of c-Raf, or the activation of MKK4 by MEK kinase (data not shown).

PD 098059 Inhibits the Activation of MAPKK in Swiss 3T3 Cells

In Swiss 3T3 cells, many agonists activate the pathway leading to the activation of p42/p44 and MAPKAP kinase-1alpha/beta, but the extent of activation differs markedly from agonist to agonist. EGF is a more potent activator of c-Raf, MAPKK, and p42/p44 than PDGF, TPA, or serum, while insulin is the weakest activator of these enzymes (Table 1). Incubation of Swiss 3T3 cells with PD 098059 (50 µM) suppressed by 80-90% the activation of MAPKK induced by each agonist, but the activation of c-Raf was enhanced 2-3-fold (Table 1).



The effect of 50 µM PD 098059 on activation of the downstream targets of MAPKK, namely p42 and MAPKAP kinases 1alpha/beta varied from agonist to agonist (Table 1). PD 098059 (50 µM) prevented the activation of p42 and MAPKAP kinase-1alpha/beta by insulin (the weakest activator of MAPKK) almost completely, but with PDGF, TPA, and serum (which are stronger activators of MAPKK) the activation of p42 and MAPKAP kinases-1alpha/beta was only inhibited by 70-80% and 26-52%, respectively. After stimulation for 5 min with EGF (the strongest activator of MAPKK) the activation of p42 and MAPKAP kinase-1alpha/beta was only inhibited by 33 and 13%, respectively (Table 1). However, as the concentration of EGF was reduced, the extent of inhibition of p42 activation by 50 µM PD 098059 increased progressively. After stimulation for 10 min with 100 ng/ml EGF, the inhibition of p42 activation was only 8%, but at 0.1 ng/ml and 0.01 ng/ml EGF it was 89 and 100%, respectively (Fig. 4). PD 098059 cannot be used at higher concentrations because of its low solubility in aqueous solution. These results are considered further under ``Discussion.''


Figure 4: Effect of PD 098059 on the activation of p42 in Swiss 3T3 cells at different concentrations of EGF. Cells were incubated for 90 min in the absence (open circles) or presence (closed circles) of 50 µM PD 098059 and stimulated for 10 min at the indicated concentrations of EGF. The cells were lysed, and p42 was immunoprecipitated and assayed as described under ``Experimental Procedures.'' The p42 activity is plotted relative to the specific activity of p42 in the lysate after stimulation with 100 ng/ml EGF in the absence of PD 098059, which was 0.45 ± 0.02 units/mg.



PD 098059 Does Not Inhibit Other Protein Kinases in Vitro or in Vivo

PD 098059 did not inhibit 18 protein Ser/Thr kinases in vitro (Table 2), including Raf-activated MAPKK1 or MAPKK2 as well as two other MAPKK homologues, MKK4 and RK kinase (see ``Experimental Procedures''). PD 098059 did not inhibit the in vivo activation of MKK4 by osmotic shock in PC12 cells (data not shown), the activation of RK kinase by arsenite in KB cells (Fig. 5B), the activation of the MAP kinase homologues JNK (Fig. 5A) and RK (Fig. 5B), or the activation of MAPKAP kinase-2 in interleukin-1-stimulated or chemically stressed KB cells (Fig. 5B). PD 098059 also failed to inhibit the activation of p70 S6 kinase in EGF- or insulin-stimulated Swiss 3T3 cells (Fig. 5C).


Figure 5: PD 098059 has no effect on the activation of JNK, RK kinase, RK, MAPKAP kinase-2, or p70in vivo. Panel A, KB cells were incubated for 90 min in the absence(-) or presence (+) of 50 µM PD 098059 and then stimulated for 15 min with 20 ng/ml IL-1 or 0.5 mM sodium arsenite (A). The cells were lysed and assayed for JNK activity using GST-Jun-(1-191) as substrate. After phosphorylation, reactions were denatured in SDS, electrophoresed on a 10% polyacrylamide gel, and autoradiographed. Similar results were obtained in two experiments. Panel B, KB cells were stimulated in the absence (C) or presence (A) of arsenite and in the absence(-) and presence (+) of PD 098059 as in panel A. The cell lysates were chromatographed on Mono Q and assayed for RK activity or chromatographed on Mono S and assayed for RK kinase and MAPKAP kinase-2. The results are given ± S.E. for the number of experiments shown, as a percentage of the arsenite-stimulated activity in the absence of PD 098059. Panel C, Swiss 3T3 cells were incubated in the absence or presence of 50 µM PD 098059 as in panel A and then for 5 min in the presence (+) or absence(-) of 100 nM rapamycin prior to stimulation for 15 min with 100 ng/ml EGF (E), 100 ng/ml, insulin (I), or buffer (C, control). The cells were lysed and assayed for p70 activity after immunoprecipitation. The results are given ± S.E. for three experiments.



Activation of c-Raf by PD 098059

The finding that PD 098059 enhanced both the basal activity of c-Raf and its activation by growth factors in Swiss 3T3 cells (Table 1) prompted us to study this effect in greater detail. As shown in Fig. 6, PD 098059 caused a severalfold enhancement in the rate of activation of c-Raf by PDGF and largely prevented the precipitate drop in c-Raf activity that occurred after 10 min in the continued presence of PDGF. However, PD 098059 only increased slightly the maximal level of c-Raf activation attained after 10 min.


Figure 6: Effect of PD 098059 on the activation and inactivation of c-Raf by PDGF in Swiss 3T3 cells. Cells were incubated for 90 min in the presence (closed circles) or absence (open circles) of PD 098059 and then stimulated for the times indicated with 50 ng/ml PDGF. The cells were lysed and assayed in triplicate for c-Raf activity after immunoprecipitating the enzyme from the lysates. The results are given ± S.E. for three experiments.




DISCUSSION

Although PD 098059 inhibits forms of MAPKK1 with a low level of activity (dephospho-MAPKK1 andMAPKK1(S217E,S221E)), we demonstrate in this paper that it does not inhibit the phosphorylated forms of MAPKK1 but instead prevents the activation and phosphorylation of MAPKK1 in vitro (Fig. 3) and in vivo (Table 1). These findings, coupled with the failure to inhibit the phosphorylation of other substrates of c-Raf and MEK kinase, and lack of competition with ATP(9) , indicate that PD 098059 does not bind to the active site of MAPKK1 but instead interacts at another site, thereby blocking access to activating enzymes. It will be interesting to find out whether PD 098059 binds to the activation loop of MAPKK1 in the vicinity of the phosphorylation sites, and our results raise the possibility that PD 098059 may mimic or displace an endogenous allosteric effector of these enzymes. Our observations explain the high degree of specificity of PD 098059, which only inhibits the activation of MAPKK2 weakly and does not affect the activities of 18 protein Ser/Thr kinases (Table 2), four protein Tyr kinases, and phosphatidylinositol 3-kinase (9) that have so far been tested. Moreover PD 098059 does not prevent the in vivo activation of Raf (Table 1, Fig. 6) or the activation of other MAPKK or MAPK homologues (Fig. 5, A and B), which lie in stress- and cytokine-activated signaling pathways, or the insulin-induced or EGF-induced activation of p70 S6 kinase (Fig. 5C).

Our results also demonstrate that inhibitors can be identified that differentiate between the active and inactive conformations of protein kinases. These observations could be of general significance and suggest that when screening for inhibitors of protein kinases, weakly active dephosphoenzymes or mutant enzymes should always be examined in parallel with the fully active phosphoenzyme. Indeed, inhibitors that interact with dephosphoenzymes and prevent their activation by upstream kinases may frequently turn out to be more specific inhibitors than compounds that block catalytic activity per se.

Although PD 098059 suppressed the activation of MAPKK in Swiss 3T3 cells by 80-90%, its effect on the activation of p42 and MAPKAP kinase 1alpha/beta in vivo depended on the strength of activation of c-Raf and MAPKK by any agonist. PD 098059 (50 µM) prevented the activation of p42 and MAPKAP kinase-1alpha/beta by insulin (Table 1) or by low levels (0.01-0.1 ng/ml) of EGF (Fig. 4) almost completely, which were the weakest activators of these enzymes. PD 098059 (50 µM) partially suppressed the activation of p42 and MAPKAP kinase-1alpha/beta by PDGF, TPA, or serum but had little effect on the activation of these enzymes at high concentrations of EGF (100 ng/ml), the most potent activator of c-Raf and MAPKK (Table 1). Although PD 098059 (50 µM) suppressed by 85-90% the activation of MAPKK at high EGF, the activity remaining was still 50% of that observed after stimulation with PDGF, TPA, or serum and much higher than that observed after stimulation with insulin. This explains why the activation of p42 and MAPKAP kinase-1alpha/beta at high EGF is hardly affected by 50 µM PD 098059 (Table 1).

PD 098059 (50 µM) does not inhibit the in vivo activation of MAPK and MAPKAP kinase-1 completely when cells are stimulated with high concentrations of agonists that are potent activators of MAPKK, and its low solubility in aqueous solution precludes its use at higher concentrations. An effect of PD 098059 on some biological processes may therefore only be revealed at low agonist concentrations or by using cell lines with low numbers of growth factor receptors. For example, we have noticed that PD 098059 inhibits the NGF-induced differentiation of some PC12 cells (10) but not others, (^2)and this may reflect the different numbers of NGF receptors (and hence the strength of activation of MAPKK by NGF) in these cell lines. Indeed, in the PC12 cell line where PD 098059 failed to inhibit differentiation, the activation of MAPK by NGF was only suppressed by 50% after 15 min, despite an 80% inhibition of MAPKK by PD 098059 after 5 min.^2 It has been established that the sustained activation of MAPK is not only required, but is sufficient to induce the differentiation of PC12 cells(2, 3) .

The results presented in Table 1emphasize how little activation of MAPKK is needed to produce significant activation of p42 and especially of MAPKAP kinase 1alpha/beta. For example, either insulin in the absence of PD 098059, or PDGF, TPA, and serum in the presence of PD 098059, caused only a 0.3-0.9% conversion of MAPKK to the activated form, yet this was sufficient to cause 13-21% conversion of p42 to the activated form and 34-77% conversion of MAPKAP kinase 1alpha to the activated form. PD 098059 would appear to be particularly useful for studying the role of the MAP kinase pathway in the biological actions of insulin, since it essentially abolished the activation of MAPK and MAPKAP kinase-1 by insulin in Swiss 3T3 (Table 1) and L6 cells (30) .

An unexpected observation was that PD 098059 enhanced the basal activity of c-Raf and its activation by growth factors in Swiss 3T3 (Table 1) and L6 cells (data not shown) and prevented the inactivation of c-Raf in Swiss 3T3 cells that occurred after stimulation with PDGF for 10 min (Fig. 6). This result suggests that the rate of activation of c-Raf is suppressed and that its rate of inactivation is enhanced by a component of the kinase cascade downstream of Raf. We have also observed that PD 098059 blocks the hyperphosphorylation of c-Raf induced by PDGF in Swiss 3T3 cells and by IGF-1 in L6 cells (data not shown), suggesting that a kinase downstream of c-Raf may be responsible for hyperphosphorylation. These results are also consistent with the increasing evidence that growth factor-induced hyperphosphorylation of c-Raf does not correlate with activation(31, 32) . Furthermore, Ueki et al.(33) reported that the overexpression of MAPK in Chinese hamster ovary cells attenuated the activation of c-Raf and enhanced its hyperphosphorylation by insulin. Although the hyperphosphorylation of c-Raf might contribute to its inactivation, other explanations are possible. For example, activation of MAPK by a variety of growth factors causes hyperphosphorylation of the GTP/GDP exchange factor (Sos), which catalyzes the activation of Ras(34, 35) . Moreover, hyperphosphorylation of Sos in stimulated cells results in its dissociation from GRB2 and hence to the inactivation of Ras(34, 35) . Treatment of L6 cells with PD 098059 inhibits the hyperphosphorylation of Sos following insulin stimulation(30) . Therefore, PD 098059 by inhibiting the activation of MAPK and hence the hyperphosphorylation of Sos in growth factor-stimulated cells may prevent the dissociation of Sos from GRB2 and thus block the inactivation of Ras that would result in a sustained activation of c-Raf (Fig. 6).


FOOTNOTES

*
This work was supported by grants from the United Kingdom Medical Research Council and the Royal Society (to P. C.). The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore by hereby marked ``advertisement'' in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

§
To whom correspondence should be addressed. Tel.: 44-1382-344-238; Fax: 44-1382-223-778.

Recipient of a postdoctoral fellowship from the Spanish Government.

(^1)
The abbreviations used are: MAPK, mitogen-activated protein kinase; MAPKK, MAPK kinase; MEK, MAP kinase/ERK kinase; MAPKAP, MAP kinase-activated protein; EGF, epidermal growth factor; RK, reactivating kinase; IL, interleukin; NGF, nerve growth factor; TPA, 12-O-tetradecanoylphorbol 13-acetate; GST, glutathione S-transferase; PDGF, platelet-derived growth factor; PP2A, protein phosphatase 2A; cdk, cyclin-dependent protein kinase; JNK, c-Jun kinase.

(^2)
S. Traverse and P. Cohen, unpublished observations.


REFERENCES

  1. Seger, R., and Krebs, E. (1995) FASEB J. 9, 726-735 [Abstract]
  2. Marshall, C. J. (1995) Cell 80, 179-185 [CrossRef][Medline] [Order article via Infotrieve]
  3. Cowley, S., Paterson, H., Kemp, P. and Marshall, C. J. (1994) Cell 77, 841-852 [CrossRef][Medline] [Order article via Infotrieve]
  4. Fry, D. W., Kraker, A. J., McMichael, A., Ambroso L. A., Nelson J. M., Leopold, W. R., Connors, R. W., and Bridges, A. J. (1994) Science 265, 1093-1095 [Abstract/Free Full Text]
  5. Cuenda, A., Rouse, J., Doza, Y. N., Meier, R., Young, P. R., Cohen, P., and Lee, J. C. (1995) FEBS Lett. 364, 229-233 [CrossRef][Medline] [Order article via Infotrieve]
  6. Lee, J. C., Laydon, J. T., Mcdonnell, P. C., Gallagher, T. F., Kumar, S., Green, D., McNulty, D., Blumenthal, M. J., Heys, J. R., Landvatter, S. W., Strickler, J. E., McLaughlin, M. M., Siemens, I. R., Fisher, S. M., Livi, G. P., White, J. R., Adams, J. L., and Young, P. R. (1994) Nature 372, 739-746 [CrossRef][Medline] [Order article via Infotrieve]
  7. Chung, J., Kuo, C. J., Crabtree, G. R., and Blenis, J. (1992) Cell 69, 1227-1236 [CrossRef][Medline] [Order article via Infotrieve]
  8. Kuo, C. J., Chung, J., Fiorentino, D. F., Flanagan, W. M., Blenis, J., and Crabtree, G. (1992) Nature 358, 70-74 [CrossRef][Medline] [Order article via Infotrieve]
  9. Dudley, D. T., Pang, L., Decker, S. J., Bridges, A. J., and Saltiel, A. R. (1995) Proc. Natl. Acad. Sci. U. S. A. 92, 7686-7689 [Abstract/Free Full Text]
  10. Pang, L., Sawada, T., Decker, S. J., and Saltiel, A. R. (1995) J. Biol. Chem. 270, 13585-13588 [Abstract/Free Full Text]
  11. Alessi, D. R. Saito, Y., Campbell, D. G., Cohen, P., Sithanandam, G., Rapp, U., Ashworth, A., Marshall, C. J., and Cowley, S. (1994) EMBO J. 13, 1610-1619 [Medline] [Order article via Infotrieve]
  12. Cross, D. A. E., Alessi, D. R., Vandenheede, J. R., McDowell, H. E., Hundal, H. S., and Cohen, P. (1994) Biochem. J. 303, 21-26
  13. Stokoe, D., Campbell, D. G., Nakielny, S., Hidaka, H., Leevers, S. J., Marshall, C., and Cohen, P. (1992) EMBO J. 11, 3985-3994 [Medline] [Order article via Infotrieve]
  14. Lange-Carter, C. A., Pleiman, C. M., Gardner, A. M., Blumer, K. J., and Johnson, G. L. (1993) Science 260, 315-319 [Abstract/Free Full Text]
  15. Derijard, B., Raingeaud, J., Barett, T., Wu, I. H., Han, J., Ulevitch, R. J., and Davis, R. J. (1995) Science 267, 682-685 [Abstract/Free Full Text]
  16. Alessi, D. R., Cohen, P., Ashworth, A., Cowley, S., Leevers, S. J., and Marshall, C. J. (1995) Methods Enzymol. 255, 279-290 [Medline] [Order article via Infotrieve]
  17. Sutherland, C., Leighton, I. A., and Cohen, P. (1993) Biochem. J. 296, 15-19
  18. Rouse, J., Cohen, P., Trigon, S., Morange, M., Alonso-Llamazares, A., Zamanillo, D., Hunt, T., and Nebreda, A. R. (1994) Cell 78, 1027-1037 [CrossRef][Medline] [Order article via Infotrieve]
  19. Baxter, R. M., Cohen, P., Ullrich, A., Downes, C. P., and Doza, Y. N. (1995) Eur. J. Biochem. , in press
  20. Schlender, K. K., and Reimann, E. M. (1977) J. Biol. Chem. 252, 2384-2389 [Abstract/Free Full Text]
  21. Cazaubon, S., Webster C., Camoin, L., Storsberg, A. D., and Parker, P. J. (1990) Eur. J. Biochem. 194, 799-804 [Medline] [Order article via Infotrieve]
  22. Davies, S. P., Carling, D., and Hardie, D. G. (1989) Eur. J. Biochem. 186, 123-128 [Medline] [Order article via Infotrieve]
  23. Smythe, C., and Newport, J. W. (1991) Methods Cell Biol. 35, 449-468 [Medline] [Order article via Infotrieve]
  24. Cohen, P. (1983) Methods Enzymol. 99, 243-250 [Medline] [Order article via Infotrieve]
  25. Walsh, M. P., Hinkins, S., Dabrowska, R., and Hartshorne, D. (1983) Methods Enzymol. 99, 279-288 [Medline] [Order article via Infotrieve]
  26. Hibi, M., Lin, A., Smeal, T., Minden, A., and Karin, M. (1993) Genes and Dev. 7, 2135-2148 [Abstract/Free Full Text]
  27. Alessi, D. R., Gomez, N., Moorhead, G., Lewis, T., Keyse, S. M., and Cohen, P. (1995) Curr. Biol. 5, 283-295 [CrossRef][Medline] [Order article via Infotrieve]
  28. Bradford, M. M. (1976) Anal. Biochem. 72, 248-254 [CrossRef][Medline] [Order article via Infotrieve]
  29. Force, T., Bonventre, J. V., Heidecker, G., Rapp, U., Avruch, J., and Kyriakis, J. M. (1994) Proc. Natl. Acad. Sci. U. S. A. 91, 1270-1274 [Abstract/Free Full Text]
  30. Lazar, D. F., Brady, J., Wiese, R. J., Mastick, C. C., Waters, S. B., Yamauchi, K., Pessin, J. E., Cuatrecasas, P., and Saltiel, A. (1995) J. Biol Chem. 270, 20801-20807 [Abstract/Free Full Text]
  31. Samuels, M. L., Weber, M. J., Bishop, J. M., and McMahon, M (1993) Mol. Cell. Biol. 13, 6241-6252 [Abstract/Free Full Text]
  32. Traverse, S., and Cohen, P. (1994) FEBS Lett. 350, 13-18 [CrossRef][Medline] [Order article via Infotrieve]
  33. Ueki, K., Matsuda, S., Tobe, K., Gotoh, Y., Tamemoto, H., Yachi, M., Akanuma, Y., Yazaki, Y., Nishida, E., and Kadowaki, T. (1994) J. Biol. Chem. 269, 15756-157661 [Abstract/Free Full Text]
  34. Cherniack, A. D., Klarlund, J. K., Conway, B. R., and Czech, M. P. (1995) J. Biol. Chem. 270, 1485-1488 [Abstract/Free Full Text]
  35. Waters, S. B., Yamauchi, K., and Pessin, J. E. (1995) Mol. Cell. Biol. 15, 2791-2799 [Abstract]

©1995 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
J. Neurosci.Home page
B. W. Luikart, W. Zhang, G. A. Wayman, C.-H. Kwon, G. L. Westbrook, and L. F. Parada
Neurotrophin-Dependent Dendritic Filopodial Motility: A Convergence on PI3K Signaling
J. Neurosci., July 2, 2008; 28(27): 7006 - 7012.
[Abstract] [Full Text] [PDF]


Home page
J EndocrinolHome page
P. Abidi, H. Zhang, S. M Zaidi, W.-J. Shen, S. Leers-Sucheta, Y. Cortez, J. Han, and S. Azhar
Oxidative stress-induced inhibition of adrenal steroidogenesis requires participation of p38 mitogen-activated protein kinase signaling pathway
J. Endocrinol., July 1, 2008; 198(1): 193 - 207.
[Abstract] [Full Text] [PDF]


Home page
J EndocrinolHome page
N. Al-Shanti and C. E Stewart
PD98059 enhances C2 myoblast differentiation through p38 MAPK activation: a novel role for PD98059
J. Endocrinol., July 1, 2008; 198(1): 243 - 252.
[Abstract] [Full Text] [PDF]


Home page
EndocrinologyHome page
F. C. Denison, S. Battersby, A. E. King, M. Szuber, and H. N. Jabbour
Prokineticin-1: A Novel Mediator of the Inflammatory Response in Third-Trimester Human Placenta
Endocrinology, July 1, 2008; 149(7): 3470 - 3477.
[Abstract] [Full Text] [PDF]


Home page
Genes Dev.Home page
K. Nadra, A.-S. d. P. Charles, J.-J. Medard, W. T. Hendriks, G.-S. Han, S. Gres, G. M. Carman, J.-S. Saulnier-Blache, M. H.G. Verheijen, and R. Chrast
Phosphatidic acid mediates demyelination in Lpin1 mutant mice
Genes & Dev., June 15, 2008; 22(12): 1647 - 1661.
[Abstract] [Full Text] [PDF]


Home page
J. Pharmacol. Exp. Ther.Home page
S. Zhuang, G. R. Kinsey, Y. Yan, J. Han, and R. G. Schnellmann
Extracellular Signal-Regulated Kinase Activation Mediates Mitochondrial Dysfunction and Necrosis Induced by Hydrogen Peroxide in Renal Proximal Tubular Cells
J. Pharmacol. Exp. Ther., June 1, 2008; 325(3): 732 - 740.
[Abstract] [Full Text] [PDF]


Home page
J. Leukoc. Biol.Home page
A. A. Khan, S. Martin, and B. Saha
SEB-induced signaling in macrophages leads to biphasic TNF-{alpha}
J. Leukoc. Biol., June 1, 2008; 83(6): 1363 - 1369.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Cell Physiol.Home page
L. H. Wei, Y. Yang, G. Wu, and L. J. Ignarro
IL-4 and IL-13 upregulate ornithine decarboxylase expression by PI3K and MAP kinase pathways in vascular smooth muscle cells
Am J Physiol Cell Physiol, May 1, 2008; 294(5): C1198 - C1205.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
T. P. Rygiel, A. E. Mertens, K. Strumane, R. van der Kammen, and J. G. Collard
The Rac activator Tiam1 prevents keratinocyte apoptosis by controlling ROS-mediated ERK phosphorylation
J. Cell Sci., April 15, 2008; 121(8): 1183 - 1192.
[Abstract] [Full Text] [PDF]


Home page
J. Pharmacol. Exp. Ther.Home page
T. Genovese, E. Esposito, E. Mazzon, C. Muia, R. Di Paola, R. Meli, P. Bramanti, and S. Cuzzocrea
Evidence for the Role of Mitogen-Activated Protein Kinase Signaling Pathways in the Development of Spinal Cord Injury
J. Pharmacol. Exp. Ther., April 1, 2008; 325(1): 100 - 114.
[Abstract] [Full Text] [PDF]


Home page
J. Physiol.Home page
J. Chevalier, P. Derkinderen, P. Gomes, R. Thinard, P. Naveilhan, P. Vanden Berghe, and M. Neunlist
Activity-dependent regulation of tyrosine hydroxylase expression in the enteric nervous system
J. Physiol., April 1, 2008; 586(7): 1963 - 1975.
[Abstract] [Full Text] [PDF]


Home page
J. Neurophysiol.Home page
C. P. Ford, K. V. Wong, V. B. Lu, E. Posse de Chaves, and P. A. Smith
Differential Neurotrophic Regulation of Sodium and Calcium Channels in an Adult Sympathetic Neuron
J Neurophysiol, March 1, 2008; 99(3): 1319 - 1332.
[Abstract] [Full Text] [PDF]


Home page
J. Pharmacol. Exp. Ther.Home page
S. N. Hamadmad and R. J. Hohl
Erythropoietin Stimulates Cancer Cell Migration and Activates RhoA Protein through a Mitogen-Activated Protein Kinase/Extracellular Signal-Regulated Kinase-Dependent Mechanism
J. Pharmacol. Exp. Ther., March 1, 2008; 324(3): 1227 - 1233.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Gastrointest. Liver Physiol.Home page
A. Nishida, A. Andoh, M. Shioya, S. Kim-Mitsuyama, A. Takayanagi, and Y. Fujiyama
Phosphatidylinositol 3-kinase/Akt signaling mediates interleukin-32{alpha} induction in human pancreatic periacinar myofibroblasts
Am J Physiol Gastrointest Liver Physiol, March 1, 2008; 294(3): G831 - G838.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Cell Physiol.Home page
R. D. Ramnath, J. Sun, S. Adhikari, L. Zhi, and M. Bhatia
Role of PKC-{delta} on substance P-induced chemokine synthesis in pancreatic acinar cells
Am J Physiol Cell Physiol, March 1, 2008; 294(3): C683 - C692.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Cell Physiol.Home page
P. Smolen, D. A. Baxter, and J. H. Byrne
Bistable MAP kinase activity: a plausible mechanism contributing to maintenance of late long-term potentiation
Am J Physiol Cell Physiol, February 1, 2008; 294(2): C503 - C515.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
B. B. Friday and A. A. Adjei
Advances in Targeting the Ras/Raf/MEK/Erk Mitogen-Activated Protein Kinase Cascade with MEK Inhibitors for Cancer Therapy
Clin. Cancer Res., January 15, 2008; 14(2): 342 - 346.
[Abstract] [Full Text] [PDF]


Home page
J. Pharmacol. Exp. Ther.Home page
S. J. Tudhope, T. K. Finney-Hayward, A. G. Nicholson, R. J. Mayer, M. S. Barnette, P. J. Barnes, and L. E. Donnelly
Different Mitogen-Activated Protein Kinase-Dependent Cytokine Responses in Cells of the Monocyte Lineage
J. Pharmacol. Exp. Ther., January 1, 2008; 324(1): 306 - 312.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Gastrointest. Liver Physiol.Home page
J. Si, J. Behar, J. Wands, D. G. Beer, D. Lambeth, Y. Eugene Chin, and W. Cao
STAT5 mediates PAF-induced NADPH oxidase NOX5-S expression in Barrett's esophageal adenocarcinoma cells
Am J Physiol Gastrointest Liver Physiol, January 1, 2008; 294(1): G174 - G183.
[Abstract] [Full Text]